PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00014955-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 300aa    MW: 32823.6 Da    PI: 6.3601
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00014955-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF69.82.5e-222471249
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                        + enks ++vtfskRr+g++KKA+EL+vLC++++a+i +s+  k y +
  WALNUT_00014955-RA 24 QLENKSTKHVTFSKRRAGLFKKASELCVLCGVDIAIIAYSPGEKAYSF 71
                        679**************************************9999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.0E-301574IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.6421575IPR002100Transcription factor, MADS-box
CDDcd002652.24E-301688No hitNo description
SuperFamilySSF554552.09E-261689IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-181737IPR002100Transcription factor, MADS-box
PfamPF003192.3E-222671IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-183752IPR002100Transcription factor, MADS-box
PRINTSPR004046.2E-185273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MAMATTCQKI KKITQGRRKI EIKQLENKST KHVTFSKRRA GLFKKASELC VLCGVDIAII  60
AYSPGEKAYS FGHPNVDTVL NSYLTGNALP AYSAVNPWPV EEFNKEYAES LKELDDEKKL  120
LADIDQDLTS KKKMGNNNIG FLWDEPIDEM GIEELEQYLA AMKEMRAKAT DQYLRMRNSI  180
NRLQTSDYKY NGGLGYYNDQ GLGDYNRHEY GNNCLSGISG TGEDVGSTSS GGFGLGINNY  240
QFGNPSSGGQ IGGDFGASSC TGFGLGNYQF CSNLQISTTA PGSSTGGYGV GDYEHHACRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002532452.24e-49PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLB9T2I31e-49B9T2I3_RICCO; Mads box protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.15e-33AGAMOUS-like 62